PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_13414
Common NameKK1_013826
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 918aa    MW: 101368 Da    PI: 6.1609
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_13414genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.27.7e-29600650252
         RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  C.cajan_13414 600 EKNVSLSVLQQYFSGSLKDAAKHIGVCPTTLKRICRQHGISRWPSRKINKV 650
                    799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.813584670IPR003035RWP-RK domain
PfamPF020425.8E-26602650IPR003035RWP-RK domain
SuperFamilySSF542774.21E-22813902No hitNo description
Gene3DG3DSA:3.10.20.2402.2E-22816897No hitNo description
SMARTSM006663.2E-22818900IPR000270PB1 domain
PROSITE profilePS5174520.408818900IPR000270PB1 domain
CDDcd064073.67E-33819899No hitNo description
PfamPF005644.5E-17821899IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 918 aa     Download sequence    Send to blast
MEYPFSPKGG GIGDWQSSRA QLEGSTSLDG GMRNSISEDM PNSFSELMNF DTYAGLCDSP  60
SITDQILANE LPSFASLPYP LPDGFNLVQQ NSGQCYMSRV GKNNNDMESS PMYGEKVGCQ  120
QMDTLLGFFS NSNDGNNLNS KLKTNGSSQH SNAFDTGNYI MSRPPGLSLD ERMLRALSFF  180
KESAGGGILA QVWVPIKHGD QFILSTSEQP YLLDQMLAGY REVSRTFTFS AEGKSGCFLG  240
LPGRVFTSKV PEWTSDVGYY SMSEYLRFEH AINHKVRGSI AFPIFDMHSE LPCCAVLELV  300
TTKEKADFDK ELEIVCRALQ LVNLRTTKPL RLLPECLSNN KKATLTEIVD VLRSVCHAHR  360
LPLALTWIPC YTEGSRGEAT RIQIKEGHST SSEKGILCIE ESACYITDRA MTGFVRACME  420
HHLEEGKGVA GKALQSNHPF FYPDVKTYDI SEYPLVHHAR KYNLNAAVAI RLRSTYTNDD  480
DYILEFFLPA NMRGSSEQQL LLDNLSGTMQ RICRSLRTVS DVELSGIGSS QVGFGKKNVP  540
SFFPLSSRNS QIPLINGDRD SSQKMSLKAT NLGNNEIEPS PSQERNGSKR QVQKNRSTLE  600
KNVSLSVLQQ YFSGSLKDAA KHIGVCPTTL KRICRQHGIS RWPSRKINKV NRSLKKIQTV  660
LNSVQGVEGG LKFDPSVGAF VAGGSIIQEI DAHKSLMFPE KNTIKDCAPD TLEAVSVPTA  720
PCSEDENFSI KQQAFAPRCK IVLNKLVWVS RYLIGDEMDI GVDGDDGVVE PNHPTSSSLT  780
DSSNGSGSMM HSNSSGSESF QNQNQSKVKS TIVDSGSILI VKATYGEDTI RFKFDPSAGC  840
FRLYEEVATR FKLQNGSFQL KYLDDEEEWV MLVNDADLQE CIEILDDIGT RSVRFLVRDM  900
PCVLGSSGSS NGYLGGSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006595076.10.0PREDICTED: protein NLP8 isoform X1
RefseqXP_006595077.10.0PREDICTED: protein NLP8 isoform X1
RefseqXP_006595078.10.0PREDICTED: protein NLP8 isoform X1
RefseqXP_006595079.10.0PREDICTED: protein NLP8 isoform X1
RefseqXP_014621587.10.0PREDICTED: protein NLP8 isoform X1
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A151SUG40.0A0A151SUG4_CAJCA; Uncharacterized protein
STRINGGLYMA13G42160.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein